TCDB is operated by the Saier Lab Bioinformatics Group
>WP_094723436.1 phosphatase PAP2 family protein [Bombiscardovia coagulans]
MTNPYGSGWSDQGASVDKGGTQAALQDLQNLANAGDLTATQEMEDMQDMDPLIGRPRASSWIACLIAGLMMVAAAMGLWW
LSAYTVAGQEYEDEVYRNFAGYVSQVPLLKSMLGVFVISKLTIGICSVVALGSYVIAALRKRWWLLGQVLIYSVVACGLQ
FLLKMTLPHPHIVDIEAMQGNSAPSGHTMLAVTAAIILVCVVPRAWRALSAVFGLLLTLAVGCSVIDGRWHRPTDVVMAI
LISGALALFMLAFTRASGMDDIGTRYSSASVQVVSTVLLTAGILGCCYGAFVVWQMVAGLQMGARWTFYGAHVSAVVFIA
SSAAIVFGTVLALRQVTASPLSKIGLLGAPPTPPGKV