TCDB is operated by the Saier Lab Bioinformatics Group
>WP_109651723.1 DUF935 family protein [Hymenobacter nivis]
MANIFKSLGQALNPFNKSIQAAGPAGFGALPGSVLETVYPVQIRRLKQDVQKWRDALDRAENVYYPERIQILNIYADVAL
DLHLSSVLETRKINVLGQAFKLVDGTGKENPAFTKMLRKPWFRQFCRYALESIDYGHSLIEFPVPVDGEFHQLTLVPRQH
VFPEAHLVRTMPGMIVGVDYENDPAYSPWLIEVGDRHSLGLLLKAAPAIIWKKTVLGAWAGFTEMFGTPYRTITGAMDGP
QMDSCNTMMANMGQAGYGVFPEGVKVDFIAPSTGNALLYDKFIERINSELSKLVLGQTMTTDSGSSRSQGEVHERVSDAY
TKEDSVFLSDLINGQLLPFLVKHGYPVAGYEFQFEDTENLGKEKQFLIVQGIMKDSGYQVNKQYLEDTFGVVLEDKPVPV
VVPLPVPPGKRAGQPSPTQPASQLPQSVAQLTSQLTSLVTAAASSQLDKLAEGVIKRVHGGDLFAGTIDGALYSYLRDHL
EGAISVGWEATDPKLRGYLSENIQRFSGFKTHAVQQAMQEKLTDADGKVRPFAEFRADALQVNQLYNVDYLETEYNTAVA
SAQMASKWSEFSDGAMLTYKTAGDDLVRAEHAEYDGITLPKDDPFWDTTYPPCDYNCFTPETNVLTPTGWQCISDLRVGD
LVIGGSGEAKAVEFVHLNHFDEHVVRLVSEEEHVLTTPNHRFLTLKGWIRAENLKAGDVVIQLPEVGGVDKDVGHIEHVR
SLVRNVRVAGPRRALRVYALNANAQFWQKHIYPIGRKVVAKLRIVPQLLEMLQHELFAFGRECFGIGVAARVCSVHAHAL
GADVLPKNGVVKLSGFALFKRHLTDRLVGFFGSAESTVFADSNKSASADAHCFGLSSTALRVVGPLHPNGLSAFARLYAT
LLHQFDKLCRLQPPPLANHAVGEYLPNVQLGEGFTDGAPLQGFDALNDFLRYAFFHLKFAKVDSIANIPYIGNVYNLSVK
EDISYVTKIGVVHNCRCDVVETDADATPTARDTLDSLPEPPIEFRNNSGKGGEVFNAEHPYFDVPKSVATKIEQQL