TCDB is operated by the Saier Lab Bioinformatics Group
>WP_118618146.1 hypothetical protein [Blautia sp. AF19-34]
MKISKDKILSFNYNYMMFIILIIQPILDIVSYFAVKYGYTSYTTIIRMIFFMGITLYSFYISKRKKIYIGISGVIAIFWI
LHMVGCWKNGYQSIPQDIAMYLRTIQMPIFTLNFITIFEKEQKYTREIEKAYVTNYIIIISSIILSFLIGMPEYTYYGGI
GIKGWFAVGNSQSCIVSIMAPLGLCFAYRKKNKILFCATLLLECVNMYFFGTRVAFFSIYIVCISFAFFLVWNKKKDITV
YGSLFIALVVCSLFYKYSPCYVNQFKTNESFSEWNNEISKIKEDNKQQDQGKIDKKTYLETYNLYCEDLVKKYGLEKVIK
KYNYSTDSSDVISNRKLKINYNKLNMDEKGIWEHAFGYEYMEFIYNGTIYDPENDFPALYFQYGYVGVALYIIFILYFAI
ITIKYLLQNWSVISIELGSVGTSLILMLGIAQYSGNVLRRPNVSIYLSVMLAYIYYLCKMETNVREKDVNEQ