TCDB is operated by the Saier Lab Bioinformatics Group
>WP_145056293.1 DUF935 family protein [Planctomycetes bacterium Pla85_3_4]
MTSPVDMPLQPSHLLTIQGAAGDSQRLYRPPDEAIRHSLENARFMRNECGVMECLEARQRGSALLPWRIIPEEDDCPAAQ
QAAAVLTRIVRRIPHFLEYRRNLLEALWYGKYAVAQRFGRIRVGGQWRIGVTHWEPRHGDKLVFRAAADGNCEPDQIGIR
VSQDPGAGNQPHASASEDPSGETPVSQIETTSQGKVYFLRQEERDLLAVHRHIIEDGPPEDPFGAGGIHGVGIRSRIYWS
WYSMQECLAFLMEYLERSALGIEVWSYPSGNAQAEAAARQAAEERISGGRSIVLVPKPLGDNAGQFGVEHIEPGLDGAGA
LRSIITDYFGHKIKRYILGQTLTSETGATGLGSGVAETHAATWLNIVRYDAQKLAETLTTDLVEPLCRFNFSSARDLPLR
LVLDVESPDIERTLAAWKAAYEMGLQLKAEEVANLIGAGRPGSQEEALGRPV