TCDB is operated by the Saier Lab Bioinformatics Group
>WP_148878533.1 DUF935 family protein [Treponema phagedenis]
MKNNLNIEIISPDKFEAVIAELPNPNEIISDKVSFYSLIDEMLLDSKIGSHLRLRKDIVTSFNFVIEQKNASDKVYEFVR
DNLTSNLNWDNDVKEFLTAIEYGFAFSEVLWAQNDAGYWIPDSLRNKRPEQIFFKTEIIKTKQGQRSIWVPMLTKENRPL
IEKCKFLIYRNNPRAENPYGFSDLLMCYWPWRFKQFGWEFWLKAAKKAGVPSIVALFESTNTEEARNAAQAISQTLSEME
GGAGLALSNVKDIKTLEMSGALQDHKVLIETCNQEISFALTTQSLSTQEGTYGTRSQAEVHDENLVRVCHGDAKAVQGVF
QELINWMVAINFGEGVAAPSGYFDLKSYATFTEIMQAIQNKIPVSKEALYTRYGLPRPKDDEDTFIVEAPQAQGFMLADS
NSKKKIQNSRSPVKIF