TCDB is operated by the Saier Lab Bioinformatics Group
>WP_156704463.1 hypothetical protein [Planococcaceae bacterium Storch 2/2-2]
MMKTKLSHTKEDFTLMEQKQYKTMLWLVAFILAQPLIDVLTTASIKLGLSSITIGIVARLVYLLAMALWITSAARTSKRA
KWYFLYLAGLALLVIANFANNYFVKDPFLIVEELTFYTKVIYFHVLFFGFLLLFEGLAAKGTNIQQLLIRYFVIVSTMIG
TVFIIAQVTGTSLANYARSKDGWTGWFYAGNEIGASMAILLPIAALYAVEKTRSIKDMKHWIPMIMLSLSMLALGTKVGY
GGVIIVLGTVLATSLILLVWKKDERDEMPKRKANLIVSTILLAALLVSTPFTPVFGNMFAHLDLLGVNVDEKDQKGPEGE
ADGKITLTGAQVENLVFSSREKYKDDYQMQFQDAPMSQKLLGLGYAGNYEMPDPENHQRLKTIEMDFHDWFYSFGFVGFL
YMVAPLIYFSALYVIRFFASFKRRFDYDHLLMGIAFLIGVGIAYTAGHVLTAPAVSIYLAFLFAAQLHTVEE