TCDB is operated by the Saier Lab Bioinformatics Group
>WP_157304638.1 hypothetical protein [Chitinophaga sp. ysch24]
MEQVTIPATNNTRQEQPEFSPVLRFVSEVIAYLSHPLFIPLIVTIVMVNALPEYFVVFKHDSVRLVYDKLVLRVISITIF
FPLLTVMIARALNFVESLKMESKKDRIIPYVANTIYFFWAYYAFKREGIAPPFFNAFFLGVFIAVIMSMVANTYFKISMH
TVGWGGVLGFLLMLMTGMHMNISQPLIAAFLVSGIVATSRLILSAHTPGEIYAGFIVGILSQLIAYGIVG