TCDB is operated by the Saier Lab Bioinformatics Group
>WP_159220376.1 LrgB family protein [Klebsiella pneumoniae]
MSDAVLSILCLVATLVLYYANKKLYRRFHKLPLMPLVFTPILLVLILVVGHISYQSYMGETHWLLWLLGPATIAFAVPVY
ENVAVIKRHWMSLSAGVVTAVVVAVTSSVWLARGFMLSDEIQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVITGVFG
MAVGDMLFLRLAIREGMAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVVVVLAAVLTLSPE