TCDB is operated by the Saier Lab Bioinformatics Group
>WP_160087698.1 phosphatase PAP2 family protein [Rathayibacter sp. VKM Ac-2804]
MTGRGPLAARVATEAFAPPVLAMVVPLIVGARVADPPLLGVAWGALAALFVGVLPYLVVRLLMRAGRIRGDHHVPDRRER
ALPIGLALVSIVVGLVLLAALGAPAAVTTFGVVTVAVLVVIGIVNLGWKLSGHAAVVATCAVVVLIAYGPWSLLITVPVA
LWTGWSRVRLGAHTPAQVIAGAVVGAVLASLVWSLLG