TCDB is operated by the Saier Lab Bioinformatics Group
>tr|X2J8I0|X2J8I0_DROME CG3332, isoform D OS=Drosophila melanogaster OX=7227 GN=DmelCG3332 PE=4 SV=1
MSLINLKSKDMYDEPINLWRTKQRVHYHHDVISKGNDNLQGTASGSTATINFQSGATSARNGSTAFFDNGAKSFQAKQQK
DKNRRTGNDAISSALSATYCKLLVLLGVCLPITEVISDQIPTYVYQGFYVYLYVGSILFVIFLYISAFRNRSLFNALKDY
HEKNSNVHLKHKVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTT
YMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHAL
NNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKN
SVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILM
RDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFAKWDTVPDRVEGIIAEVFGVVQTSLQTMFILHSSHRR
CRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHLEFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKI
TYKAKAH