TCDB is operated by the Saier Lab Bioinformatics Group
>XP_001635296.1 P2X receptor E isoform X1 [Nematostella vectensis]
MSLLHYITYKLVVIRDKRLGTIYYTFVAAIILFTLVEIFVFKGYLEYDTSPEGTMRILVSDPKDDNDNHPVIKTHVPSYC
CKGNANRTCSLCEYIDAQELSWPIESHTINLMTFGKDRWQVKQRNDSFLKQEFVNIREKKYFTVNPEEVMIKVEHSIVAT
RFTRKSGKEQVAASQRSMKGYLYDAQGKIIQSIPATNFKKPGLGQADKLTVQELLNAAGIDSLEQPSDALNAKGKSFRRH
GMVLHVGICYHNTETTLIGTGNIEYSYHVRRIPYADYRINQVIPIIGADDFSFTDDKTLTRPEKRLFRKRYGIKIEFHQS
GKLGRFSLPALLLKLVSGVGLLTLTATIVDTAALYLLPDRFQYREFVYEESPVIDKRRCKGGEQRSDETATKSKKES