TCDB is operated by the Saier Lab Bioinformatics Group
>XP_001702091.1 predicted protein, partial [Chlamydomonas reinhardtii]
AAAQQHNNFDPSGKYKLKCEGAFVAVECAISESDGLKSQGSVMVTMSGNVDIDTKMEGGLGSSLLRCCCAGGSMFFSHYS
IKPGQGPRGDVLLAPPVPGEIMLLHLDGAQGWVVQPGGYLACDHSVNIGVKMLDIAQGCCGGEGFFVMEANGRGRLLICS
YGAITRYDLAPGEKRKIDNGYCVAWTSGMEWNIAKAAKGLWNTVISGEGLVANFTGPGTVFVQTRSMQNLANALAWVYGS