TCDB is operated by the Saier Lab Bioinformatics Group
>XP_003571051.2 uncharacterized protein LOC100844080 [Brachypodium distachyon]
MRNAAAVAAMSTSGSSSSLSSMNPGSYVTGSGGVQQAVQQPPAFWSTPTPYLFIGFAVVMSLIAVALAVLLCSRRRDDED
DEEISRRREEAEADRVPAGMMSVRVLAPLDREPRLVVVMAPGHDAPSFLASAAPLAAYAAAAASKAVPSTPPRTCQCYAK
EDAKDGAVDAV