TCDB is operated by the Saier Lab Bioinformatics Group
>XP_005489475.1 uncharacterized protein LOC102066727 [Zonotrichia albicollis]
MTEEQDSPNPGDLIEIKRGPYEHWALYMGDGYVINLTPLDEEATTLSASSGSIRTRKARVQKELLKVARNDWAVNNMCDS
FRTPLPVEEIIWRAERCNGKDVTYDVLGRRSEEFVTNLRYGGELRALLCGEMHVLDRAEDKVFPNPGDLIEIKRGRFEHW
ALYLGKGHVIHATIGDTSRHSSGSAFLRKAIVKKEDLKDVVGNHRWRVNNKYDCYRTPFPMKEIIRRAEPWIGKELPYRL
FRKNCEHFVTMLRYGDGVSRQAKAALQNINSISSVVTAGIGVTSLAVAAGIPVVGLPLLACAPFVVAGGGGLLASIGFTS
SNIARSFSSAQFEKAGRDILEQSCC