TCDB is operated by the Saier Lab Bioinformatics Group
>XP_007903208.1 PREDICTED: transmembrane protein 206 [Callorhinchus milii]
MASALIRRDIGGTYTELAEDEAERANISPEIRNEPDVEQEDANGGVFRDDVSSASHSSIFGKACLKNTFAVILIFIYLLL
MSVAVFLAYQTITDFREKLKHPVMSVSYQEVVTFDAPGIALYLAKAEVLSCKHYYHDHIQPLAHPSQRGATDCVTEHVNY
TDPFSNKTMKYALVVRGPRDVRKREVVFLQFRLNETEQDFSAIDYLLFSSFEEFQESPDKVLFMKNCELSYSIWTFSGGF
RTWVKMSLVKTTEEDGSQSVEFRQESSVVKYNDRRPTAERTDQLFFVVFEWKDPFIQEVRDIVTANQWNTIAILCGVFLA
LFKAAEFAKLSVKWMIKIKRRQQKIKTQELNQMS