TCDB is operated by the Saier Lab Bioinformatics Group
>XP_012055154.1 PREDICTED: gustatory receptor for sugar taste 64e-like [Atta cephalotes]
MGDTVNVSSEVYGKTLKTNQIFSAGSKISKRNGVTCKKILPYLMRQKKDKMKEMETQFSSDSQSPIPSPPRSRPFLNEQT
LSISSNDPESFHCVMGPILVMAQLFGILPVSGILMPSPLQIKFVKFSIRTIYSAFISGMVLFMAILSIIHMIKIINSATF
EVQGDMVAATSGTIFYANCVMGLIIFFWLSSRWVTLQRDWRSMELFIDSNKMERPKLRWKLYLIAISILFVALIEHILSI
LVHVKKYDWSGKSDNATFPNFLEIYCTSSHAFILENLKYNLALGIFIFIVSKLATFTWNFTDVFIAMVATGLAERYKTLN
KYVINSISKHRPIDWSGLREDYATLSFMVKKVDDDISPVILLSFVNNLYFICLQLLNGLSKSDEGIIGDIYFFESFLFLI
SRTMIVTLLTARIHDQSKVILPILFTCSTSTYDKETERLLHLLSTDNITLTGMRFFSITRNFLLAVAGAIVTYEVVLLQF
NVAMNK