TCDB is operated by the Saier Lab Bioinformatics Group
>XP_018080333.1 PREDICTED: carcinoembryonic antigen-related cell adhesion molecule 1-like [Xenopus laevis]
MHKVKPIVGQSCSVQAPLNRPVLAPKAGRDGVITLMLASWCWCSDAGARSDAGVHSNVVDQSAGEKMMASQRCDQQDPRG
VARRRSVSCLQNVSRNESESVIFTVKLNLPAQNQRLVTWRFGTSTIATAIQGNTPTYSNSCTDRCSLYGNASLQLDNVTR
ADTGNYTLTVTNIDTTVQQTEQFHLTVYGPLTPPNLTVTNPTNGNPYLVNDTNVTLQCDSGGQNVVNYIFYKDENITACS
QPQVTCDKDFLYFQPITMSDTGRYTCKIENPVGSNTSQPLSLTVIGRVSVTLSSNASSGLLRAGKDSVNLTCSSLGINVT
FSWYLDGAPLPPNPRYHLMNSNSSLIISPVERTDNGSFTCIGSNFVNNDTSKPLNLNLTWTPDGDIQCIADKKDKNVTLS
CSWEGGKPAAHVTLAFKNINKTELEKVSEIVSEANVSNTDSMLCNGSQLEHQFCMLLLDVPQGITKPPEALEQGRPAILS
VTLNSNKMRASSSTHILPATFSWFDPREQSLSNVDGYSINSSDSSSKLEIHSLKPIDNGTFICVATNIMGNYTFKFEVKV
PQVEGGGGGSPLSAGAIAGIVIGSLAGVALIAVAVFFIVKSTKKKQTNGSSGNPQMNLTEVPNKKQEDEEYVKYADLRFK
NTNPSNKAETQQVPETEYSTVKR