TCDB is operated by the Saier Lab Bioinformatics Group
>XP_018799113.1 PREDICTED: putative gustatory receptor 98b [Bactrocera latifrons]
MKFSESTLIAVIAPYLWMFSLFAVVMPPNYILRAAPTNRHWILYIIRTVFVLYMLAQFVISFWVAYTYNVLLSGFLMRNS
LDIMTCVLSIGINVVQLVVQITVYVQALTKYTLLRDVLNDIVQLESDIRKHLTTDCSLASFRWRLGLRVGIWFVVVSTFV
PYLSYMLYTQYFHPIKRGIIVFFGTIIHFKGVEYCISVQTIQELLQLVQQQLVHLRRELVRCERVELRLSLYDDLQTNQK
LLGRVWNLLNQTERYFFIPMLMLFFINGFAIIQAIHWAYINFERDNLNLRLYRIIYTVMIILALLIPCYLSQCCIDEYNR
FGTILHKLKTMGIDEQLNMRLQEYSLQLMHQKMLFTCGGFFDINLKNFGAISLTITTYIVILIQFKLQAETEKKSNSGIR
FE