TCDB is operated by the Saier Lab Bioinformatics Group
>XP_022692159.1 atlastin-1-like isoform X2 [Varroa jacobsoni]
MATEDRKPDALCIFSLNKKLEAFGCADLRKYFDTNGEMENLKVAVVSIAGMWRSERRFLLSCIIRYLRSGGAPDWFHARK
QAEAVKWENFPEGVALWPEIFKVRQLNGEDVAVLVMDTQGLYGTKNASAESTAVLCFSVLLASIQIYNVYQHIRGTDLYA
FENFLKFVSKSVFRAPLGQKLVFVVSDWPVSLKYPYGWEGGQDVLQEELFREGHGAPTSQFLKIGRCIKKTFTSVQCYLM
PYPGEDLVCSACEQDNKGKRERYKQFIRNA