TCDB is operated by the Saier Lab Bioinformatics Group
>XP_024902250.1 transmembrane protein 25-like isoform X3 [Pteropus alecto]
MPCLHLPNDRGSGHPQLALYLDKQLQEGSTSGLLSVSRDAFCGGTITFTIAAQWAQLKCSLQDLDSGLLTTWMEVPLLGI
VVAGRLALGTLVAFSTLVAYLVFRNEKKTKACTCHRRTWPSCPTFSSTTSLQIPKRNQQTSRWLRTTAGQNFWTQSLAAS
SLAKVSPAP