TCDB is operated by the Saier Lab Bioinformatics Group
>XP_026285898.1 uncharacterized protein LOC113211663 [Frankliniella occidentalis]
MHEIYYLWRILRGLCLLPATFTETGYISFSWTSWVTLLTVSFWAVMAPYAAMVCYLIAAAEIEKTGDQKEGLQEFSQMAA
VTIVTMFEVYVPVPLFLSMRSFTKLTYSWERMEIKYLKLTGSPPKLGIKPLTYGLFVITQVYSVILLVGLHDQIGWPFWM
MLPFTHAVLCTVSITMVWVSGYVAIAVLAYDLARRTFKDCEAQGVTGLRRHRLLWLHIVKLLHTFHSCWSAVQAPLIFWT
FVISTLYFFNFIRTLMLSWDGLSACVYSFTILTCKEINLLRKLGQNLLVWIACAGCLFFVCFSAQIATESVTCARQTVLR
LPLSRRGAFFQNEAFTFLEEMREKQLSLTLNGFIAINRSRVITMMVVALTYCIVLSQFTLLK