TCDB is operated by the Saier Lab Bioinformatics Group
>XP_027555443.1 transmembrane protein 25 isoform X18 [Neopelma chrysocephalum]
MANASEFLLLGATHYPGLANHSLHIHLSSVAGNFSVSAANSVGITTTSLLPTGLLDAHVELPLLGVAVGAALALATLLSL
GSCAACLACRSPKPVPGPGRAEGSSPPSRCSRCSGSEHPQPQGTRLPRQTRSLPPDLHLSDLAQEDGASPKDVGAGARGE
DSALPGLENYLVLNKLAPNVWAHLQSAQRKQRRDLAVSRGAHGQVPGPRYVPAPGAGQPRVPGRLFWEVGAEQPWLCATL
PTAGLKSCAGSQSMFLCSPFTFPIDCYNQNASKLFIARL