TCDB is operated by the Saier Lab Bioinformatics Group
>XP_027842582.1 uncharacterized protein LOC114123716 [Aphis gossypii]
MQYKSDCYEYLRLTHVLAIFWGMPITRRRTTDNVKRNRDLANEHDGYRYSFDQRVVPVWLAYAALDAFLLYYNYLEASGY
VGESLRKCFEDSYCFAVIELANRNVGPFSALVCTMFYGHRHKAAALAGTERTLAFIRDTDRDATHGGSVWPLDSRYYSAA
VIAAYSLCIWLYAAAVPAAVLLVIWLNALGQTTVYGLATFQYHVLGHGYARVNRLLEAAANSGGQPSSDFRSLAALLDRL
ADTCDDFGRQVGHLNVAYTPGLLLRWPYSMIRLTMVVFRISELWVASQDGRPFAQVAAVLIVEHVGEILLFLVQLSSFCY
AGTRLSYQAQNTTASLQKLKLCRKPSVYLNSDVRKKVNIFLIQVNARKVNATIGGFVIVNMNLMKAICGIIVTYFLVLIQ
FKSQKGKSKPLHHIWN