TCDB is operated by the Saier Lab Bioinformatics Group
>XP_028664059.1 epidermal differentiation-specific protein-like [Erpetoichthys calabaricus]
MNKIIVYEHQNFQGMSREFTKTVPSLIDENFNDCISSLMIIGAPWVAYEHPNFKGRQFAYEEGQYANAEWNDAYSSLQII
TDNLDDPLITLYEHANYGGRKKDVTLETNLLFSDFNDTASSHIVHRGVWVLYEHGDRGGRQIIARAGEKVANYGDLSFND
QLTSLRPLKYGSPTVKAKIQWEKMVKESEKNVKIDELVGVNRSDTDQSFSSTATKEYETYVSQSISFSNSTTITVGSKFS
LDIVPGVGMETSISASNTFTVEKGKTESSTSREKTEINLPVKIPPHTELTVSVMRKEMSVRVPVEFTVTRGSNTKKEYGE
YRCSSGSSVNAEYSSKHAVMK