TCDB is operated by the Saier Lab Bioinformatics Group
>XP_032068351.1 lymphocyte activation gene 3 protein [Thamnophis elegans]
MTLLLLFCTLVLILQMTSGEKYKVWGEEGIGVTLPCYLSPQVVKDNLRHLHKGLEIHWVRHGGSSSMKRHLVLKVKPSGL
KSLAHSMMRRVTVWDTGFLKGNFSLQINPLLKEDAGTYEAHVSHGNKDWHCLVELGLVSVTAHPSRPLIESESVRLNCKS
SHPGNPTNVLWFHRDVLVRTSYRLHPMGQTLLITESVSSDSGHWVCQLTFADGEIIVVRYNLQVIGFTEQAPSVIYTAAG
SDAHLPCVLNSNPTNYGISEVAIQWRYMTGRDLKAKPTPSYEHYQDFTLHLPAVGFNDAGQYLCEITIQGVTIIQNVTLA
VMTVITNIGPRIPEGSDLVLICNLSYYTGKEHFQWKWLDLESSNSSQSGSSRPVKWGPIQEFRQVSSRDAGIWECSAHGP
EGKLGSVQYHLEIAASAQLASLPSVPTETIFGLLLFFLVVLLFIIALVYLRRRMYSLNFQALDRIVDALPGKIEKNGSQK
KTLELEY