TCDB is operated by the Saier Lab Bioinformatics Group
>XP_040271895.1 vascular cell adhesion protein 1-like [Bufo bufo]
MKACQVLLSLFTVILLNQVRSQDTLEFGAISSEVFVPFGEAVWLNCSTHKPDQTIYESRLYKNQTKRGPNWLAVQVIVRD
WENSTCVCMLDTRNYIFTSHTIVMAYALPSDITIDLQTELQEGKEYTINCMVHEVAPLEYLTINIIRGGDVIDSKSYKGP
HVVNRRTVSRLHTFTAHLSDNLMKFSCEAILQLGSELHTVKSTEITVQTYSMSPLSASRCVQERNGYVNFKIVRSQDTME
FGAISSEVFVPFGEAVWLNCSTHKPDQTIYESRLYKNQTKRGPNWLAVQVIVNDWENSTCVCMLNTRDEILTSHTIVMSY
ALPSDVTIDLQTELQEGKEYTINCTVHEVAPLEYLTINISRGEDVIDGKSYEGPHVVNRRTVSHLHTFTACRSDNLKDFS
CEAILRLGSEVHTVKSTEITVQSYTLPSDITIDLQTELQERKEYIINCTVHEVAPLGYLTIYSTDQNRGGDVIDTKSYEG
PHVVNRRTVSHLHTFTARRSDNFMTFSCEAILRLGSEVHTVKSTEKTVQTYMRSQDMLGFGATSSELFVSLGEAVWLNCS
TPKPDRTFYDTRLYKKKTERGPNWLAVQAIVRDWENSTCVCVLDSGDIFLTSQTIVMAYEGLPYHTRTAECLTAYGRILK
HCSGLYIVTGFAGVTSALCKTLMSKPGRFRFSSGRNK