TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009118962.1 E protein [African pouched rat arterivirus]
MGSVWSIVSQAVYDAFVEFVTSVLDIVLFLGILFALTFAAKLVGFFIILVFRTLKSCKRDSGGTPTLPELGKYA