TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009177198.1 alpha1 protein [Koolpinyah virus]
MSRINWPSLDGIKTVLKEFPEKINTEIKEFSHNLVSKIRYIWVWLVLIVLLLLLIKLLPKTINCIIGCKRCYNNFSSGNK
RLKEEKEETA