TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009966415.1 hypothetical protein HWA86_gp37 [Pseudoalteromonas phage HP1]
MMLTQGVLIVLLVAVALVLAACAVLTFVRFSLNASKWEGFWTVSSMLSALRIISTYTGRFSSGGKEYTVQPYDGRFVVKA
GDGGVEFYNHISGISYHWSHGHINQCTKFRTKEEAEEELAKSVSLSPKAKVGDAKHLMMLLPIAAVLDVIWYLFCMSPVA
AVSVVSTFVLTFSTRWLSGKLSDTVSKSK