Transporter Information: | |
Name: | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d |
---|---|
Symbol: | ATP5H |
TC: | 3.A.2.1.3 |
Enzyme: | 3.6.1.34 |
Locations: | 12q13 |
Aliases: | ATPQ, ATP5JD |
GenBank: | AF087135 |
Swiss-Prot: | O75947 |
Accession Number: | NM_006356 |
GDB | GDB:137191 |
LocusLink | 10476 |
PubMed (11042152): | Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G,Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ,Chen Z. Cloning and functional analysis of cDNAs with open reading frames for 300previously undefined genes expressed in CD34+ hematopoietic stem/progenitorcells.Genome Res. 2000 Oct;10(10):1546-60. PMID: 11042152 [PubMed - indexed for MEDLINE] Three hundred cDNAs containing putatively entire open reading frames (ORFs) for previously undefined genes were obtained from CD34+ hematopoietic stem/progenitor cells (HSPCs), based on EST cataloging, clone sequencing, in silico cloning, and rapid amplification of cDNA ends (RACE). The cDNA sizes ranged from 360 to 3496 bp and their ORFs coded for peptides of 58-752 amino acids. Public database search indicated that 225 cDNAs exhibited sequence similarities to genes identified across a variety of species. Homology analysis led to the recognition of 50 basic structural motifs/domains among these cDNAs. Genomic exon-intron organization could be established in 243 genes by integration of cDNA data with genome sequence information. Interestingly, a new gene named as HSPC070 on 3p was found to share a sequence of 105bp in 3' UTR with RAF gene in reversed transcription orientation. Chromosomal localizations were obtained using electronic mapping for 192 genes and with radiation hybrid (RH) for 38 genes. Macroarray technique was applied to screen the gene expression patterns in five hematopoietic cell lines (NB4, HL60, U937, K562, and Jurkat) and a number of genes with differential expression were found. The resource work has provided a wide range of information useful not only for expression genomics and annotation of genomic DNA sequence, but also for further research on the function of genes involved in hematopoietic development and differentiation. |
>sp|O75947|ATP5H_HUMAN ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3 MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVP VPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIEN L |