| Transporter Information: | |
| Name: | potassium inwardly-rectifying channel, subfamily J, member 11 |
|---|---|
| Symbol: | KCNJ11 |
| TC: | 1.A.2.1.2 |
| Locations: | 11p15.1 |
| Aliases: | BIR, Kir6.2 |
| Swiss-Prot: | Q14654 |
| Accession Number: | NM_000525 |
| GDB | GDB:7009893 |
| LocusLink | 3767 |
| OMIM | 600937 |
| PubMed (7502040): | Inagaki N, Gonoi T, Clement JP 4th, Namba N, Inazawa J, Gonzalez G,Aguilar-Bryan L, Seino S, Bryan J. Reconstitution of IKATP: an inward rectifier subunit plus the sulfonylureareceptor.Science. 1995 Nov 17;270(5239):1166-70. PMID: 7502040 [PubMed - indexed for MEDLINE] A member of the inwardly rectifying potassium channel family was cloned here. The channel, called BIR (Kir6.2), was expressed in large amounts in rat pancreatic islets and glucose-responsive insulin-secreting cell lines. Coexpression with the sulfonylurea receptor SUR reconstituted an inwardly rectifying potassium conductance of 76 picosiemens that was sensitive to adenosine triphosphate (ATP) (IKATP) and was inhibited by sulfonylureas and activated by diazoxide. The data indicate that these pancreatic beta cell potassium channels are a complex composed of at least two subunits--BIR, a member of the inward rectifier potassium channel family, and SUR, a member of the ATP-binding cassette superfamily. Gene mapping data show that these two potassium channel subunit genes are clustered on human chromosome 11 at position 11p15.1. |
>sp|Q14654|KCJ11_HUMAN ATP-sensitive inward rectifier potassium channel 11 OS=Homo sapiens GN=KCNJ11 PE=1 SV=2
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
| |