| Transporter Information: | |
| Name: | solute carrier family 39 (zinc transporter), member 7 |
|---|---|
| Symbol: | SLC39A7 |
| TC: | 2.A.5.4.1 |
| Locations: | 6p21.3 |
| Aliases: | H2-KE4, D6S2244E, KE4, RING5 |
| GenBank: | AF117221 |
| Swiss-Prot: | Q92504 |
| Accession Number: | NM_006979 |
| Old Name: | HLA class II region expressed gene KE4 |
| LocusLink | 7922 |
| OMIM | 601416 |
| PubMed (8812499): | Ando A, Kikuti YY, Shigenari A, Kawata H, Okamoto N, Shiina T, Chen L,Ikemura T, Abe K, Kimura M, Inoko H. cDNA cloning of the human homologues of the mouse Ke4 and Ke6 genes at thecentromeric end of the human MHC region.Genomics. 1996 Aug 1;35(3):600-2. PMID: 8812499 [PubMed - indexed for MEDLINE] cDNA clones corresponding to the HKE4 and HKE6 genes at the centromeric end of the HLA region on human chromosome 6p21.3 were isolated and characterized. The predicted amino acid sequences of HKE4 and HKE6 exhibited 81.5 and 85.6% identity to the mouse homologues, Ke4 and Ke6, respectively. HKE4 may encode a membrane protein with histidine-rich charge clusters. HKE6 possesses remarkable amino acid sequence conservation with several bacterial proteins with oxidoreductase function and also shows significant homology with the two unique functional domains containing the nucleotide cofactor binding site and the consensus motif characteristic of the members of the superfamily of short-chain alcohol dehydrogenases such as human and rat steroid and prostaglandin dehydrogenases. |
| PubMed (1855816): | Hanson IM, Trowsdale J. Colinearity of novel genes in the class II regions of the MHC in mouse andhuman.Immunogenetics. 1991;34(1):5-11. PMID: 1855816 [PubMed - indexed for MEDLINE] To examine the degree of conservation of gene organization in and around the class II regions of the major histocompatibility complexes of mouse and human, we have established the positions of sequences homologous to five human non-class II genes (RING1-5) in mouse, and the positions of sequences homologous to three mouse non-class II genes (KE3-5) in human. The resulting comparative map reveals that the organization of genes in the entire proximal region of the MHCs of mouse and human is remarkably conserved, apart from the H-2K gene pair in mouse, which can be accounted for by a 60 kilobase (kb) insertion. The characterization of the novel human gene RING5 is also presented. This gene, which is widely expressed, maps 85 kb proximal to the DPB2 gene. Partial nucleotide sequencing of a RING5 cDNA clone reveals that it is the human homolog of the mouse KE4 gene. |
>Q92504|KE4_HUMAN Zinc transporter SLC39A7 - Homo sapiens (Human). MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHESIWHGHTHDHD HGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVES NSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV KGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGY LNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALL TEGGAVGSEIAGGAGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE | |