TCDB is operated by the Saier Lab Bioinformatics Group
« See all members of the family

Influenza Am2-Bm2 Chimeric Channel of 35 aas with 1 TMS. This hybrid sequence is RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG with the N-terminus derived from AM2 and the C-terminus derived from BM2 (PDB# 2KIK) (Pielak et al. 2011).

Accession Number:357380318
Protein Name:A Chain A, Structure Of The Influenza Am2-Bm2 Chimeric Channel
Molecular Weight:
Species:unknown [109647]
Number of TMSs:1
Substrate H+

Cross database links:

External Searches:

  • Search: DB with
  • BLAST ExPASy (Swiss Institute of Bioinformatics (SIB) BLAST)
  • CDD Search (Conserved Domain Database)
  • Search COGs (Clusters of Orthologous Groups of proteins)
  • 2° Structure (Network Protein Sequence Analysis)


Predict TMSs (Predict number of transmembrane segments)
Window Size: Angle:  
FASTA formatted sequence