TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0BI49|A0BI49_PARTE Uncharacterized protein OS=Paramecium tetraurelia GN=GSPATT00029252001 PE=4 SV=1
MIKDLYYTYICKPLQYSQYKCSPNDVTLASSIPRSDYLNNKQLSFNSFEKVLMILGAVTKIQKVNSTVLGQDRLIRTYTF
LLRVFKLHLLKKIKSGECLRMWQNKLDALCSHFSMTRRILRWSRTAFYLQILFNKLSQQKSNHHFKHYRNLYDILFYTYL
IITDISDIIYWMCLIGLCNNTNLQKFTKEYAPRFYLIECIGWFISLCFEYRVNQIDIAKANLQKDPKNKIKIRQIQILQN
LVKYALDIPVSYSYVNTQAITQEKAVILGTFSSIISLYQTFKLHSGGFQ