TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0CTU9|A0CTU9_PARTE Uncharacterized protein OS=Paramecium tetraurelia GN=GSPATT00010450001 PE=4 SV=1
MNQSQFLQSLNFDPLRSPPLREIAQRHKRATMCGLLIESNDFCQCCGLGIHTHPISLKANIINLAFLGQGIPLFYNITFL
LILLTFILLLIFGLPTIIFNFLAENCIEQTNEAYNIFITQGCSKNCPQEQDDFKLIQQLISNSDCTVICQHYQELCIATL
LSEMSFTNKQLEDDLKIIQSFFVFGSVIFIKIYLVLIREKQRIIEAECDQELISPSDFTAMLNHLPEEDYDEKELATAIE
QYCQKIDSSNKYEVIKINIAYDIKSFVLKSREKIKLEKILAEEQKYYIKNQKYKRNKQEIEKIKLMVEQLKKELANIEIE
IENGSYRKTTSVAFITFQTKQQLQKLIQQTKLSYWEQLLMQVKRLIQNKDKRGFYFKDNLISICRAPEPDDIFWENCGIE
NSIKIKRKFISWIVVFVLLGISFATLYGLEYLQNQYLSNDLDFITKTSLSLLKSLIITIVDALIYYFITLLANHERHVTK
THQDTSVAQKLCCVQFINSCFLLLLIHLIGVGQKGDFMEKSKYAIQKQGGIANDLLFVCCMNALFTPITAFFNPIYFIKK
LQQLFIESNKSLTQLEANKLFEGPQVLLYDQYAFICKTTWITLFLAPLTPICIFINWIGLSMYYWIQKYLLLRRNSKPPF
QSSHLDREMLTLLDLSPLLLAGMQYWIDEIYDSNYLSHSINIGTLVIAGLELVFPSYRIHQILYRKQLEDIENQRYIDVH
LRFTTDYDRTNPLTSEQATQEFMKKKFQQFNKQMTYKRNSRMQSTKRSLREYVQKGIQSANISRIQILKRKLQIAYKLKM
FQNIQQETKYKESDREDSIHTFNFPAYQRAPQYNFSRVINQFPNYCQYNSDLTSRSNSISSTIQLNTSKYQLTTKRNSQI
QSFRAPLQ