TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0CYX2|A0CYX2_PARTE Chromosome undetermined scaffold_31, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00011590001 PE=4 SV=1
MQIPLLYTIMFISSVYVWKQIKRYFNLSANAKLKTLSVATSVLLMILNQRFLIGNCSSIVECIHIKVDLNSILFPLICNT
FLFLGPIYNQIMDKVLIKENSVNRFNQNQVFDDRMLIRIVLAPLLEEITFRALFYQNIEDQSDFRLITSILFSLAHSHKF
FSFFKKERKYRSIYNNEANKFRDFKACFMKALLTTLFILMFTFIFGFYAATVFLKTRSLISVILLHSYCNYLGFPKLKQI
FSNTKINIIKSINQLYNLVVLVVYFVGIVFFYYFITM