TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0JCJ5|A0JCJ5_PLESH Cytotoxic outer-membrane protein OS=Plesiomonas shigelloides GN=comp PE=4 SV=1
MKKTILALAVPALLAAGVTNAATVYNNDGTKIDLKGSIRLLAEDGARRDADLSDDSSRIGLGINHDLGNGLSGLGYIEMG
YDTQMPETNSKSTIKNRLAYAGLSLDGVGTLTAGRITAPFDDVAVSDYTWTYGGVMDFGKMQNNADRGPFGQKNTFLART
SNSVKVESAEFNGFKAAGSYTMQTGDNTSDVKNAYTLAAFYTSDFGLTFNAGYGHGKSVGQEASLNTAAINAVDADIWGI
GAQYQIADFSIGLDYGQAKLDWNTAGESNSKADLLGVGVKYQIIEQTKVYAGYYGRDYSDYKNWDRHDLYVVGTDYAFSK
NVVTFLEYAHDDYKYVKPTTDVKNDDRIGLGFRVYF