TCDB is operated by the Saier Lab Bioinformatics Group
>A0L4K8|A0L4K8_MAGSM ABC transporter, inner membrane protein - Magnetococcus sp. (strain MC-1).
MDKIMRIAQKEFQSFFASPAAFLFLGAFLAATLFIVFWVETFFARNIADLRPMFQWMPLLLIFLVAALTMRSWSEERRSG
TLETLLTSPVNPLHLIAGKFAAALALVVVGLALTLPLTLTVALLGPLDWGPVLGGYIATLFLAAAYVSIGLFMSARTDNP
IVALILTTAVCGLFYFIGSPTLTNLFGHEVSHFLALLGSGSRFDAITRGVVDLRDLYYYLSLVGVFLTLNLFTLERLKWA
GNPISQRHKQWGWLTALLVANFVAGNLWLGSIGWLRQDMTAGKLYSLSEATQQQLQQLQEPLQIRGYFSAKTHPLLAPLV
PQIRDLLKEYAQLSKGRVEVAFIDPQRSPALEEEAASRYGIRPVPFQMASRHQASVVNAYFDLVVAYGDQFQKLSYTDLI
EIKSGASRELEVMLKNPEYAITQSIRKVQHAYQSGGNPFEGLAHPVTFTGYLSQPLPAGVEKLQGALQSALDELTAQGKE
KFKVQFKDPGQDPALAKQLKQDYGFKPQIASLLDPQPFWFYMVLTGNDSDGIPVPLPEELTKEGLKRTIEAAVQRMAPGF
LKNITLTTATPAPAGMMGRAPTPGKGYTLLQEALGESLKVTSNDLQSGQVPAQTDLLMVMGPDKLNEKQLFAMDQFLMQG
GTVVLATSPFDVDLQGSLSVANKHDAGLTEWLASHGITLQEKMVLDAQKASLPVPVTRYIGPMAVEEIQQFPYPHFPDLR
GASLNPKSPITAGLGQLTINWASPIVVDAEPNKTRQVIPLLHSSKQSWSSDALNILPDYQAYPDQGFPKPDSQEPQLLAV
ALEGRFDSFFKDKASPLLHEQEAPSAHAPEEKAQQTDPEPTKPQFGGVLEHSSPEARLILIASNGFASDEVLSLASQGAG
TLYNKPIELLQNSIDWALQDAALMQIRGRMQFARTLLPMSDGSRMVIEYFNYGLVLLGLLGIWLWRRAVRLRQLRRHQAI
LAEV