TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0L4K9|A0L4K9_MAGMM ABC transporter related protein OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=Mmc1_0376 PE=4 SV=1
MAPDRPFKANLIRKPDPLGSQPKTSLGDCMIEVSQLSRVYGDYTAVEACSFAIQRGEVVGLLGHNGAGKTTIMKMLTGFL
EPTSGTILIDGLALNREANTVQGRIGYLPENCPVWPEMTVMAYLEYHADLRGIADIDKPRAIARAIRRTALQEKALAPIA
TLSRGYRQRVGVAQAILHDPDIIILDEPTNGLDPTQIRQMRDLIRELAKEATVILSTHILQEVQAVCERVLILKQGKLVV
DATLATLQSGGRLRLTTAKTAQATLASQLESAQIESLPSTDGLYHYALNVPAQQTPQIAQAVVEGGLGLHGLHFEKQNLE
SLFAQINQQPQTHGEVGHG