TCDB is operated by the Saier Lab Bioinformatics Group
>A0L4L0|A0L4L0_MAGSM Putative uncharacterized protein - Magnetococcus sp. (strain MC-1).
MAQRAAIVALFDQLQEPKLKWNINTLNLLQEVTLHEQHLRVVVHLITGDRQQRIAFEEQARQAIQAIHTGSLELIVAQAQ
VGTEGIQGVKRIILVASGKGGVGKSTVAVNLAVGLNLLGHKVGLMDADIYGPSVPTMLGCHDKPQVLPHEYLLPLQRHGI
RFISTGSLVDPGKALDWRGPLVSGTLLQFITKTCWGELDYLIIDMPPGTGDAQLTIASKLKTHGVVLVTTPQEVAWGDVR
RAIELFQKQQAPILGIVENMNHQVCTACGHQSHPLIHSQLPLPPGIVSLAQLPLAHEISQAGDAGVPLLLQESSSPAKAA
LLALAQRVAQCTAPTQEPA