TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0RZH5|A0RZH5_ERWAM Outer membrane protein 39 OS=Erwinia amylovora GN=omp39 PE=4 SV=1
MKRNILAVLIPALLAAGAANAAEIYNKDGNKLDLYGKVKAMRYLSDADSNASNNADKSYTRIGFKGQTLINDQLTGYGQW
EYNFSLSNSESSSDAQSGNKTRLGFAGLKLKDYGSVDYGRNYGVIYDVEAFTDMMPEFGATGYTRTDTYMLTRGNSMLTW
RNSDFFGLVDGLKIALQYQGKNEGSGTRATNVSNGDGYGASLSYKIVEGLTINGAMSSSNRLNANSASSTTSQKMAAYGS
GGRAEAWATGLKYDANGVYLAGTYAETRNTNPFSGASYTFAGNSTATAVSGYANKVQNTELVAQYQFDSGLRPSLAYVQT
KAKDIENGIGDADLSKFVDVAATYYFNKNMSAFVDYKVNLLSDSNKLHLNTDDIVAVGLVYQF