TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0ZUB1|A0ZUB1_9PSED Putative ABC transporter protein OS=Pseudomonas sp. MIS38 PE=3 SV=1
MTQALLQLTGITRSFTAGDREFLALKDINLTINAGEMVAIIGASGSGKSTLMNILGCLDYATAGSYRINGQETRDLDDQA
LAELRRDYFGFIFQRYHLLPHLSAMHNVEMPAIYAGIPAPQRHARARELLARLGLDGHLTHRPSQLSGGQQQRVSIARAL
MNGGEVILADEPTGALDTASGKEVMRILLELHAAGHTVILVTHDPKVAANAERIIEVSDGEILSDRRNQRDTGQLSDEDV
PPKPPATRRLVASLGLFKEAFNMAWVALISHRMRTLLTMLGIVIGITSVVSISAIGEGAKNYVLKDISAIGSNTIDIYSG
SSFGDKRAASIETLVPADVTALNQLYYVDSATPVVGRSMLLRYRNIDLDAQINGVSDQYFQVRGIKLEAGITFSESDARR
QAQVVVIDYNTRHRLFGEGVDPLGQVILIGNLPCTVIGVAAENKNLFASGKTLNVWVPYETAAGRILGQRFLDSISVRIK
DGQSSKVVENHVTQLMLQRHGIKDFYTNNLDSVMQTVQKTSRSLALLLSLIAVISLVVGGIGVMNIMLVSVTERTREIGI
RMAVGARQSDIRQQFLVEAVMVCLLGGAIGISLSYAIGHLFSLFIKEWEMVFSMASVLTAVICSTLIGIVFGFVPARNAS
RLDPIEALARD