TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1JRS3|A1JRS3_YERE8 Putative uncharacterized protein OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=YE2426 PE=4 SV=1
MKTHGINGIRPFSAIIDACWRETYTLQRFIKDIIAGITVGIIAIPLAMALAIASGVPPQYGLYTSAIAGIVIAVSGGSRY
SVSGPTAAFVVILYPVSQQFGLAGLLLATLLSGVFLLCMGLGRLGRLIEYIPLSVTLGFTSGIGITIATMQVKDFFGLHL
PEVPETYVGKVAALAQALPTINFSDTLIATVTLMVLILWPRLKLKLPGHLPALVAGTAVMAVLSLFDHQVATIGSRFGYL
LADGTQGHGIPPILPQFVLPWHLPAANGQEFVLNWATLSALLPAAFSMAMLGAIESLLCAVVLDGMTGQKHHSNSELVGQ
GLGNMVAPFFGGITATAAIARSAANVRAGATSPVSAIIHALLVLLALLVLAPMLSYLPLAAMASLLLIVAWNMSEAHKVV
DLLRRGPKDDIIVMLLCMSLTVLFDMVIAITVGIVLASLLFMRRIARMTRLSEIPTEMNEHRLVLRVNGPLFFAAAERIF
NELLSRSENYDTIILQWDAVPVLDAGGLNAFLRFTEALGEHQQLIITDIPFQPLKTLARARVQPIEGKLSFYGSLPEALA
ALAAK