TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1QYM3|A1QYM3_BORT9 Uncharacterized protein OS=Borrelia turicatae (strain 91E135) GN=BT0073 PE=4 SV=1
MKNSLIMYLLVNNLLLIHFIGIEDIKIKDNKTLSKKYLIVIITSLLIYSSLFYLYKLFSEHNLLFIIPIIYITLIYILTI
ILKTLNNILIVYNNKSKYSNDFLLSNSSLIAITFFSLDKSHNFLEGIKILILSSLSVLIALILITLTKKSFEKKLTSKIL
ANETIYFFIMFILSLIPNIIMLINNIEGL