TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2G2I4|A2G2I4_TRIVA CLN3 protein OS=Trichomonas vaginalis GN=TVAG_244010 PE=4 SV=1
MNNSEVDSFGNPVETTQQNEIQQQPADNIEPVETSSSEKKWKIINYIGMLLIGLINNLPYWVAYANTQAICTHFNKDGYI
GAVSWGIVILSIFATLGNAFLTSKNVSYNIRSIINGAFMFVGLIGTAVAPNIFVAILFIAFVGVSSDFGEGVMLGYFASL
DNDALLGAWGIGTGISGVFGAGYSLICQKFKVSYFLSFICMSPTGILYPLIFILMLKNPNTATKVPEQEEPEKLEDIEQN
DAAIDKQDEEEKVPFCSCSNWYKSLRFILNNLAMFCFQYISLIGLTDCSMTKKQKVDEPFIFGYFSICYQCGGLIGRSIK
KWFLIKKLEITTVITGCLFVIMLVNAIVVFIAPIYMLIPLFLIGFFGAISYMSVFAVIMEVPNTTQKEREIITNYASVFI
GGSIQVSSLITLLLQNVIIKKQCSRE