TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3DGJ1|A3DGJ1_CLOTH Heavy metal transport/detoxification protein OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=Cthe_1849 PE=4 SV=1
MKNNFTANKLYVQGMTCTGCETRIENVLRKLDGVTDVKASYTSSTVYVAYDKSKLNLDKIIETVEKLDYKIKGVEDEKNA
GYDKRENFAPENGSKTETGQLLGIIIVFLAFLLIIKNGRVFNFIPEIDRSMSYGLLFVAGLLTSLHCVAMCGGINMSVCM
QYKSAGGKSKALGSSDGKTGKAVEFEQLMPSFLYNLGRVISYTVVGGVVGALGSVISFSGAAKGVVAIISGVFMVIMGLN
MLNIFPVLRKITPRMPKIFGRKISNAKNKGPLLVGLLNGFMPCGPLQAMQLYALGTGSFIAGATSMFMFSLGTVPLMFGL
GAISSIAGGKFTQKMMRISAVLVIVLGVVMFNRGLSLSGYSFPIFYADSAKGASIARIEGDVQVVETQLEPGRYAPIVVQ
KGIPVKWTIKANKEDLNGCNNAIVAREFGIDNRKLEVGDNIIEFTPAREGEFVYSCWMGMIHGYIKVVNDINEIDQDDIN
LKNEGFNLNKILPKGCCGI