TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3K8R2|A3K8R2_9RHOB Uncharacterized protein OS=Sagittula stellata E-37 GN=SSE37_14894 PE=4 SV=1
MLMRRAIALVLLTVLWLALPAFATGSMIVHMVLHLGVVAVVPLLWAPRLPAAFPSGPIALALGSVVDMAVVWTWHLPGMH
LWARLDTMGLILEQASFLGAGLLLWGAVRQAGPFGGVLVLLATTMHMTLLGALIGLAPRDLYGDICAGHFGLTALQEQQV
AGVLMAGLGGALYLAAALGRLGRALDEGEPA