TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3KDM5|A3KDM5_TOBAC Protein DETOXIFICATION OS=Nicotiana tabacum OX=4097 GN=NtMATE2 PE=2 SV=1
MGKSMKSEVEQPLLAAAHGGSSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN
LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSLTGIPLAVVYLFSKNILLALGESK
LVASAAAVFVYGLIPQIFAYAVNFPIQKFLQSQSIVAPSAFISLGTLFVHILLSWVVVYKIGLGLLGASLVLSFSWWIIV
VAQFIYILKSERCKATWAGFRWEAFSGLWQFVKLSAGSAVMLCLETWYFQILVLLSGLLKNPEIALASISVCLAVNGLMF
MVAVGFNAAASVRVSNELGAAHPKSAAFSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEVVAKEVSSLCPYLAVTL
ILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKEV
ESARKRLDKWENLKGPLNKE