TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3MW01|A3MW01_PYRCJ Tungstate/molybdate transport system permease protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_1398 PE=3 SV=1
MMDAVKAVAASTAALLALLLLALPLFFLSAPPPGFVESFLFTAAASAAAAGGSLLPGLAVAMAARRGGAWGALGMVLYVP
ALVPPTSVGVLLLAAFSTPRLLCGDCPLSQFVSAWVVNQPLGVFLAMWVMALPVAFSIYDGALREERAEAFFRSLGFSGL
RLLVLTAMSLREATLSAALFAWLRGFGELGVLLIFANYPYAASIYIYNAWLIYGVGPAIGASLAVVVTALAVGYAARRWL
SR