TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3MW02|A3MW02_PYRCJ Putative uncharacterized protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_1399 PE=3 SV=1
MSPLAPPPSSATTPAPTSAAVSQTQSSAQAAACGGSVIGYVAPTLVRVVKDAAREAGLSVEGIQSVGSLEGLRRIQQGSV
PDVYASVDIELAADVKDARQIYSLGRFKLALACARPIASVSDLRGAKTALADPNKAPIGYRELAVAYMLKKGGVADLTAR
YEALGIRFVDTAVGFNVTVPTALFSTAEVKVAPSLDGSWSMFETGQVDCVFAYLPFILGKGVELKPAGASAELWEVYVGD
YGRGQFYVYVFKPPYDFFQDPPLAIYVNFVDPSGRVVRAVRVGRFEAFVASFTERGDCVVEALKKMDLAKYGFVK